PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g008010.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 466aa    MW: 52470.5 Da    PI: 5.989
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g008010.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.7e-52972241128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv +yL++k+ gk++++ e+++e+d+yk+ePwdL+  +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd
  Sopim11g008010.0.1  97 LAPGFRFHPTDEELVRYYLRRKACGKPFRV-EAVAEIDVYKSEPWDLKdySALKTRDLEWYFFSPVDRKYGNGSRLNRATGEGYWKATGKD 186
                         579***************************.89**************85337777888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v + +++ +g+kktLvf+kgrap+ge+t+Wvmheyrl
  Sopim11g008010.0.1 187 RNVNH-NSKIIGMKKTLVFHKGRAPDGERTNWVMHEYRL 224
                         ****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6393247IPR003441NAC domain
PROSITE profilePS5100558.77497247IPR003441NAC domain
PfamPF023657.9E-2899224IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MAFSWIFDFR VKQLCFTSNL HKPNTLFPLL YFSLFILYVS VVSLVGFLKG IFLCFFLVPE  60
MEQEGALVLA PAPVGPVQPV PPVAPRRAVG VFSATSLAPG FRFHPTDEEL VRYYLRRKAC  120
GKPFRVEAVA EIDVYKSEPW DLKDYSALKT RDLEWYFFSP VDRKYGNGSR LNRATGEGYW  180
KATGKDRNVN HNSKIIGMKK TLVFHKGRAP DGERTNWVMH EYRLDDKELD AAGVVQDAFV  240
LCRIFQKSGL GPPNGDRYAP FIEEEWDDDT APLVAGGVTE NDVANGNQAR VEGNEFDQDV  300
RGKAPCVSEN LFEPRALSFV CKRERSEDLE LLSLSQSKRS KHDDPSSSHA NGSEDSTTSQ  360
QDPPTKTMAT TYSPTLLTFP LLDEPKEAPP TNSFNFDSSN LEKSVPPGYL KFISNLENQI  420
LNVSMERETA KIEVMRAQAM INILQSRLDF LNKENEDLRG LIRRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-509224715168NAC domain-containing protein 19
3swm_B4e-509224715168NAC domain-containing protein 19
3swm_C4e-509224715168NAC domain-containing protein 19
3swm_D4e-509224715168NAC domain-containing protein 19
3swp_A4e-509224715168NAC domain-containing protein 19
3swp_B4e-509224715168NAC domain-containing protein 19
3swp_C4e-509224715168NAC domain-containing protein 19
3swp_D4e-509224715168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ5132890.0JQ513289.1 Solanum lycopersicum NAM-like protein (NLP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015058199.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLK4D5620.0K4D562_SOLLC; Uncharacterized protein
STRINGSolyc11g008010.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.27e-93NAC domain containing protein 50